>
产品中心 >
Recombinant_antibodies >
Antibodiesinc/Anti-GluA2/GluR2 glutamate receptor (L21/32)/20 µL/75-002-020

NeuroMab
Monoclonal
Mouse
IgG1
HumanMouseRat
EMIHCWB
Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 (also known as Glutamate receptor 2, AMPA-selective glutamate receptor 2, Glutamate receptor ionotropic AMPA 2, GluR-B, GluR-K2 and Gria2, accession number P19491)
Mouse: 98% identity (49/50 amino acids identical)Human: 98% identity (49/50 amino acids identical)100% identity between Flip and Flop isoforms70% identity with GluA3/GluR3 and less identity with GluA1/GluR1 and GluA4/GluR4
Does not cross-react with GluA1/GluR1, GluA3/GluR3 or GluA4/GluR4 (based on KO validation results)
Glutamate receptor 2 (GluR-2) (AMPA-selective glutamate receptor 2) (GluR-B) (GluR-K2) (Glutamate receptor ionotropic, AMPA 2) (GluA2)
Gria2 Glur2
Purified: AB_2232661Purified Trial-Size: AB_2232661TC Supernatant: AB_10674575
TC SupernatantHybridoma tissue-culture supernatant (5mL) generally containing 10-50 ug/mL monoclonal antibody (clone-dependent) can be a very economical choice.Supernatant is suitable for most applications including Western Blot, immunocytochemistry, immunohistochemistry etc. For applications requiring higher antibody concentration or purity (such as immunoprecipitation, microinjection, or conjugation) it is recommended that you purchase the purified form of the antibody (supplied at 1mg/mL).
Purified mAbsProduced by in vitro bioreactor culture of hybridoma lines followed by Protein A affinity chromatography. Purified mAbs are >90% specific antibody at 1mg/mL.